The goal of this group lab report is to learn how to mine a draft genome to identify, extract, annotate, and validate a target protein-coding gene using bioinformatics tools. Through this investigation, you will gain practical experience working with genome assemblies and interpreting genomic data in a biological context, preparing you for genome-scale analyses in modern genomics.
As part of this lab, students will learn how to mine a draft genome to identify, extract, annotate, and validate a target protein-coding gene, and interpret their findings in a biological context. Specifically, students will:
R tools to organize data, execute analyses, and support the extraction, annotation, and validation of genes (see Tutorials and Mini-Report 3).This lab report is primarily based on the following publication:
Additional references are provided throughout each section to help you master the material covered in this assignment.
This lab report guides you through a research-style investigation that integrates scientific reasoning with hands-on bioinformatics analyses. You will work with a draft genome to identify, extract, annotate, and validate aquaporin (AQP) genes, and interpret your findings in a biological context.
The assignment is organized into the following sections:
Group Activity 1: Investigating a Draft Genome Study and Its Genomic Resources You will collaboratively read and discuss the publication that forms the foundation of this lab report. This activity introduces the biological background, research question, and genomic resources generated in the study.
Group Activity 2: “Where’s Waldo?” – Designing a Genome Mining Strategy Building on the first activity, you will develop the theoretical framework needed to identify aquaporin genes in a draft genome. Using the Waldo analogy, you will define the key features of AQPs and design a bioinformatics strategy to locate them in genomic data.
Remote Computing and Bash Tutorials
This section introduces the core computational tools used in this lab, including remote access (ssh), job management (tmux), and Bash command-line workflows.
Introduction This section presents the key concepts needed for the report, including the scientific question, hypothesis (and predictions), methodology, data availability, and report structure. Use this section as a reference throughout your analyses and writing.
Objectives and Scientific Question This section defines the specific objectives and research question you will investigate in this assignment.
Bioinformatics Analyses In this section, you will perform the analytical steps required to mine a draft genome and characterize aquaporin genes.
The analyses are structured in two stages:
Group Lab Report Detailed guidelines for writing and organizing your group lab report.
Group Lab Oral Presentation Guidelines for preparing and delivering your group presentation.
Evaluation Rubrics Criteria used to assess your lab report and oral presentation.
By the end of this activity, you will be able to:
In this 1 hour and 40 minute group activity, you will work in groups of 3–4 students to investigate the publication that forms the foundation of your Group Lab Report: Melton et al. (2021)
Through this activity, you will:
This activity will help you understand how genomic datasets are generated, organized, and shared in public repositories. It will also prepare you to navigate these resources and apply similar approaches when mining the draft genome analyzed in your Group Lab Report.
As a group, read the Abstract and Introduction, then discuss:
Group Outcome:
Write a brief summary (2–3 sentences):
What question does this study address, and why is a draft genome needed to answer it?
Now read the relevant parts of the Methods and Results sections.
Discuss the following:
Group Outcome:
Explain in your own words:
How did the authors go from raw sequencing data to biological discoveries?
Goal: Learn how to locate and interpret genomic data associated with a published study.
You will use the Data Availability Statement of the publication to locate the genomic resources.
Locate and record:
Go to:
Select BioProject and enter the accession number.
Discuss:
Locate the SRA data.
Discuss:
Locate the genome assembly record.
Discuss:
Discuss:
Now think about your upcoming Lab Group Report.
Discuss:
Group Outcome:
Write:
What will you be able to discover by mining this genome?
We will conclude with a class discussion.
Each group will share:
This activity prepares you to:
These skills are essential for your Lab Group Report.
By the end of this activity, you should be able to:
In this 1 hour and 30 minute group activity, you will work in the groups assigned for this lab to develop a strategy for identifying aquaporin genes in a draft genome using a “Where’s Waldo?” analogy.
Just as finding Waldo requires knowing his defining features (striped shirt, glasses, hat), identifying genes in a genome requires understanding the diagnostic characteristics of the target gene family.
This activity is inspired by the study: Melton et al. (2021)
Through this activity, you will:
Rather than directly running analyses, you will focus on designing a logical and justified pipeline that you will later apply in your lab work.
This activity will prepare you to:
Finding a gene in a genome is like finding Waldo in a crowded illustration.
To find Waldo, you need to know:
Similarly, to find aquaporin genes in a genome, you need to know:
👉 Goal: Develop a strategy to identify aquaporin genes from a draft genome assembly (FASTA format). This will be fundamental to conduct the bioinformatics analyses.
Using:
Answer:
List at least 3 key features that define aquaporins:
💡 Hint: Think of these as “Waldo’s stripes and hat”.
Fill in the table:
| Subfamily | Full Name | Localization | Key Features |
|---|---|---|---|
| PIP | |||
| TIP | |||
| NIP | |||
| SIP |
👉 What are the minimum features needed to confidently recognize an aquaporin?
You are given:
Discuss:
List possible approaches:
👉 Which approach would you start with and why?
What type of BLAST would you use?
Justify your answer.
What would you use as a query?
Put the following steps in logical order:
Complete the workflow:
How will you confirm a candidate is truly an aquaporin?
List at least 4 criteria:
Identify at least 3 challenges:
What could you add?
In 2–3 sentences:
👉 How is finding aquaporins in a genome similar to finding Waldo?
👉 What makes bioinformatics both powerful and uncertain?
This document supports analyses aiming at mining the sagebrush (Artemisia tridentata Nutt; Asteraceae) draft genome for Aquaporin (AQP) genes and it is based on data and analyses presented in Melton et al. (2021). AQPs are multi-exon genes (see Figure 7.1) encoding for a large family of proteins known to function in the transport of water and other molecules across cell membranes (reviewed in Li et al., 2014).
Figure 7.1: Flowchart showing the structure of a multi-exon gene and different resulting proteins. As a reminder, exons are pieces of coding DNA that encode proteins. Different exons code for different domains of a protein. The domains may be encoded by a single exon or multiple exons spliced together. In the case of multi-exon genes, the presence of exons and introns allows for greater molecular evolution through the process of exon shuffling and alternative splicing. Exon shuffling occurs when exons on sister chromosomes are exchanged during recombination. This allows for the formation of new genes. On the other hand, exons also allow for multiple proteins to be translated from the same gene through alternative splicing. This process allows the exons to be arranged in different combinations when the introns are removed/spliced. The different configurations can include the complete removal of an exon, the inclusion of part of an exon, or the inclusion of part of an intron. Alternative splicing can occur in the same location to produce different variants of a gene with a similar role, such as the human slo gene, or it can occur in different cell or tissue types, such as the mouse alpha-amylase gene. Alternative splicing, and defects in alternative splicing, can result in a number of diseases including cancer.
The defining characteristics of AQP proteins include having:
While the NPA motifs are generally highly conserved, there are some AQP genes that have undergone mutations of the alanine residue in the NPA motif (Ishibashi, 2006).
AQPs in flowering plants comprise five subfamilies (Danielson and Johanson, 2008):
Genes from each subfamily tend to move water or other substrate depending on their NPA motifs. Some AQPs, such as NIPs, have acquired a mutation in their NPA motif, such as alanine to leucine, which confer the ability to move substrates such as urea or ammonium (reviewed in Chaumont et al., 2005).
Figure 7.2: Example of a 3D model of an Aquaporin protein recovered in the sagebrush genome. NPA motifs are shown by red/orange colors
The instructor teaches students to conduct analyses by going over each module in class demonstrating the approach to mine genome for target gene and go over steps to assemble and validate protein product. Then, each group will be assigned a scaffold (from the de novo genome assembly) and they will have to conduct analyses presented in modules 2 to 4 on their own to answer the following question:
What Aquaporin protein coding sequence is “hidden” in your assigned scaffold?
Very much the same as with the “Where’s waldo?” children books, students will be able to make predictions to “find” their Aquaporin protein coding sequence based on material presented in the Introduction and further developed in modules 2, 3 and 4. These material will allow students to design their analytical workflow covering the following major steps:
The FASTA file with scaffolds sequences can be downloaded here. The scaffolds assigned to each group are as followed:
Let’s complete the training first going by through each module and then students will be working in groups to replicate these analyses to their assigned scaffold.
Each group is composed of 5 to 6 students, with a mix of undergraduate and graduate students to promote peer learning and knowledge exchange.
Each group is divided into two subgroups (A and B). Both subgroups will perform the same analyses in parallel, working independently at first.
This structure is designed to:
Each group has been assigned two accounts:
Each subgroup must use its assigned account to complete the exercises.
You will access the Linux systems using the ssh protocol. Details on your account information are available here.
All data associated with this project are located in your account in the DraftGenomeMineR/ directory:
~/DraftGenomeMineR
Key files:
Draft_Genome_Assembly.fasta: Sagebrush draft genome assembly (scaffold level)FASTAs/PIP1_3.fa: Reference file containing the PIP1 protein sequence for BLAST analysisLesson_Modules/: Scripts associated with each moduleThis module is dedicated to presenting approach to set-up your working environment and then to identify scaffolds in the de novo genome assembly containing AQP genes (using BLAST).
Start by using ssh protocol to connect to your Linux computer. This is done as follows (enter password when prompted to):
#SSH with bio_11 as example
ssh bio_11@132.178.142.214
R v.4.1.3!!WARNING: YOU DON’T HAVE TO INSTALL R!!
The code used in this lab depends on a specific version of R (version 4.1.3 (2022-03-10) – “One Push-Up”) and it needs to be installed on your computer prior to starting the tutorial. This can be done by following the procedure described on these two websites:
http://genomespot.blogspot.com/2020/06/installing-r-40-on-ubuntu-1804.html
https://www.digitalocean.com/community/tutorials/how-to-install-r-on-ubuntu-18-04
Disclaimer: The right version of R was already installed on our lab computers, but if you wanted to execute this code on your personal computer please make sure you have the right version of R!
Before starting this tutorial, do the following:
tmux session entitled “Lab” on your remote computerDraftGenomeMineR/ and start a new R session:#Navigate to DraftGenomeMineR/
cd DraftGenomeMineR/
#Start R session
R
Lab_mining_genome.R on your personal computer!!! DON’T EXECUTE THIS CODE !! The instructor already installed the R packages on your computers, but the code below shows you how these packages were installed.
Some of the required packages cannot be installed with install.packages() and require the BiocManager R package to be installed. We are also installing some packing directly from GitHub repositories.
#Check if BiocManager is installed and if not install it
if (!require("BiocManager", quietly = TRUE))
install.packages("BiocManager")
BiocManager::install()
#Install the other packages using BiocManager
install.packages("devtools")
library(devtools)
BiocManager::install("Biostrings")
BiocManager::install("ORFik")
#Install required packages for this tutorial
install_github("mhahsler/rBLAST")
install.packages("remotes")
remotes::install_github("GuillemSalazar/FastaUtils")
install.packages("ape")
install.packages("seqinr")
To conduct the analyses, you need to load R packages and source R user-defined functions. Please copy the following code in your R script and then execute it.
# This will make a list of packages that another function will use to make sure they are all installed and loaded.
list.of.packages <- c("ape",
"Biostrings",
"dplyr",
"FastaUtils",
"ORFik",
"readr",
"tidyr",
"rBLAST",
"seqinr",
"stringr")
# Use lapply to load all of the packages in the list.
lapply(list.of.packages, require, character.only = TRUE)
Functions/:# Load all of the functions written for DraftGenomeMineR
files.sources <- list.files("Functions", full.names=T)
sapply(files.sources, source)
To be able to navigate between folders within our project, we will set an object entitled project.folder, which contains the path to the root of the project folder.
To create this object, do as follows:
#Copy the output of getwd() in the object as follows:
project.folder <- getwd()
Call project.folder in the Console to check that it is correct. It should return:
"~/DraftGenomeMineR".
project.folder as follows:#Set working directory
setwd(project.folder)
In this section, you will perform a BLAST analysis to identify scaffolds containing AQP genes. For this analysis, you will need the following files:
Draft_Genome_Assembly.fasta: The file containing all the scaffolds (= draft genome)FASTAs/PIP1_3.fa: The file containing an AQP protein sequence used to mine the draft genomeUnique_Filtered_Blast_Hit_Info.csv: A CSV containing the results of the BLAST analysis (= which scaffold matches the AQP protein sequence)# There are a few parameters that need to be set.
# Let's create some R objects to store file paths and parameters for the BLAST search.
# We need a query (a fasta file of a gene you want to find in the draft genome), a draft genome assembly, BLAST databases, paths to other required folders (described in the README), and other parameters that can be used to filter results.
query.file.path <- "FASTAs/PIP1_3.fa"
genome.file.name <- "Draft_Genome_Assembly.fasta"
genome.path <- "FASTAs/Draft_Genome_Assembly.fasta"
blast.db.path <- "BlastDBs/Draft_Genome_Assembly.fasta"
AA.BlastDB.folder <- "AA_BlastDB/"
AA.ORF.folder <- "AA_ORFs/"
max.e <- 5E-50
perc.ident <- 90.000
query.type <- "AA"
blast.type <- "tblastn"
make.BlastDB <- T
BlastDB.type <- "nucl"
FASTA format:# Read in the genome assembly file
genome <- readLines(con = genome.path)
head(genome) # Print the top 6 lines of the fasta. There should be no spaces in what is printed. Each header should be on one line, followed by its entire scaffold on the next.
# Do you need to make a BLAST database or use an existing one?
if(make.BlastDB == TRUE){
setwd("BlastDBs/")
makeblastdb(file = genome.file.name, dbtype = BlastDB.type)
}
FASTA format:# Read in the query. What type of molecule is the query? DNA (or RNA) or amino acid sequences?
setwd(project.folder) # Previous lines changed the wd, so we need to go back to the project folder.
if (query.type == "DNA") {
query <- readDNAStringSet(filepath = query.file.path,
format = "fasta")
} else {
query <- readAAStringSet(filepath = query.file.path,
format = "fasta")
}
BLAST needs to be installed on the computer):# Now we have everything set up and can perform a BLAST search.
bl <- blast(db = blast.db.path, type = blast.type) # Create an object with the BLAST database and the type of BLAST search to perform.
cl <- predict(bl, query) # Perform the BLAST search
head(cl) # Look at the top BLAST hits
# We can now filter out bad BLAST hits using a few thresholds and parameters. This leaves us with only the best matches to our query.
# What parameters do you think would give you just the best candidates to be your gene of interest?
cl.filt <- subset(x = cl, Perc.Ident >= perc.ident & E <= max.e)
cl.filt.unique <- cl.filt[!duplicated(cl.filt[,c('SubjectID')]),] # SubjectID is the column that contains the scaffold names
cl.filt.unique
nrow(cl)
nrow(cl.filt)
nrow(cl.filt.unique)
blast.hits.to.extract <- subset(x = cl.filt.unique, SubjectID == cl.filt.unique[1,2])
csv file:# We have evaluated the top BLAST hits and can see a clear best hit. Let's save this data so we can extract just that scaffold later.
write.csv(x = blast.hits.to.extract, file = "Unique_Filtered_Blast_Hit_Info.csv", row.names = F)
Unique_Filtered_Blast_Hit_Info.csv using e.g. vim.In this module, we are conducting the following tasks:
FASTAs/Draft_Genome_Assembly.fasta) and saving the output as a FASTA object/file.FASTA object/file. In molecular genetics, an Open Reading Frame (ORF) is the part of a reading frame that has the ability to be translated. An ORF is a continuous stretch of codons that begins with a start codon (usually AUG) and ends at a stop codon (usually UAA, UAG or UGA). We will study the code implemented in findORFsTranslateDNA2AA() to fully understand the applied approach.pdf maps will be saved in ORFs_map/.Before starting analyses in R, students have to complete these following tasks:
ssh protocol.DraftGenomeMineR/) using cd.Output_FASTAs/) using mkdir to store results of BLAST scaffold analysis.ORFs_report/) using mkdir to store results of ORFs analysis.R session using R-4 command.DraftGenomeMineR/.For an example of code, see below:
#1. ssh
ssh svenbuerki@132.178.142.214
#2. Navigate to DraftGenomeMineR/
cd DraftGenomeMineR/
#3. & 4. Create new folders to save files
# --> If these folders already exist then don't execute the following code
mkdir Output_FASTAs/
mkdir ORFs_report/
#5. Start R session
R
#6. This will make a list of packages that another function will use to make sure they are all installed and loaded.
list.of.packages <- c("ape",
"Biostrings",
"dplyr",
"FastaUtils",
"ORFik",
"readr",
"tidyr",
"rBLAST",
"seqinr",
"stringr")
# Use lapply to load all of the packages in the list.
lapply(list.of.packages, require, character.only = TRUE)
# Load all of the functions written for DraftGenomeMineR
files.sources <- list.files("Functions", full.names=T)
sapply(files.sources, source)
#7. Copy the output of getwd() in the object as follows:
project.folder <- getwd()
#Set wd
setwd(project.folder)
In this section, you will use the output of the BLAST analysis to extract the scaffold containing the AQP gene. For this analysis, you will need the following files:
FASTAs/Draft_Genome_Assembly.fasta: The file containing all the scaffolds (= draft genome)Unique_Filtered_Blast_Hit_Info.csv: A CSV containing the results of the BLAST analysis (= which scaffold matches the AQP protein sequence)Output_FASTAs/Scaffold151535.fa: A FASTA file with the scaffold containing the AQP gene!!NOTE: Don’t forget to copy paste the code in your R script!!
R, open Unique_Filtered_Blast_Hit_Info.csv containing results of BLAST analysis and extract name of target scaffold(s)#Open BLAST file
cl.filt.unique <- read.csv(file = "Unique_Filtered_Blast_Hit_Info.csv") # Output of module 1
#Scaffold IDs
cl.filt.unique$SubjectID
FASTAs/Draft_Genome_Assembly.fasta)#Open draft genome file
genome <- readLines("FASTAs/Draft_Genome_Assembly.fasta")
#Check formatting of file
head(genome)
#How many scaffolds?
Nscaff <- length(genome)/2
#Extract scaffolds in a loop
#Create data frame to store scaffold data
scaffold <- data.frame("scaffoldID" = character(length(cl.filt.unique$SubjectID)), "scaffoldSeq" = character(length(cl.filt.unique$SubjectID)))
#Start populating data frame
scaffold$scaffoldID <- cl.filt.unique$SubjectID
for(i in 1:nrow(scaffold)){
# Find and Extract seq of each scaffold from draft genome FASTA file
scaffold$scaffoldSeq[i] <- genome[match(paste0(">",scaffold$scaffoldID[i]), genome)+1]
}
#Convert into FASTA format
scaffoldFASTA <- apply(scaffold, 1, paste, collapse="\n")
#Save/export FASTA file
write.table(scaffoldFASTA, "Output_FASTAs/Scaffold151535.fa", row.names = F, col.names=F, quote = F)
In this section, you will find ORFs along the scaffold containing the AQP gene. For this analysis, you will need the following files:
Output_FASTAs/Scaffold151535.fa: A FASTA file with the scaffold containing the AQP geneORFs_report/Scaffold151535_ORFs.csv: A CSV file with all predicted ORFs along scaffoldAA_ORFs/Scaffold151535_ORFs.fa: A FASTA file with AA sequences for all predicted ORFs (= input for module 3)ORFs_map/Scaffold151535_ORFs_annotated.pdf: A PDF with the map of all recovered ORFs along the scaffold!!NOTE: Don’t forget to copy paste the code in your R script!!
We will now find ORFs in scaffold(s) using findORFsTranslateDNA2AA(). This user-defined function (UDF) relies on functions from the ORFik R package. The output will be saved in ORFs_report/.
Let’s first look at the structure of the findORFsTranslateDNA2AA() function to understand the applied approach:
##################################
#WARNING: DON'T EXECUTE THIS CODE#
##################################
#####~~~
#A UDF used to findORFs in scaffold file (FASTA format) and produce AA sequences as well as report
#####~~~
findORFsTranslateDNA2AA <- function(scaffold, scaffoldID, MinLen){
#Extract scaffold sequence (and convert to right format)
seqRaw <- scaffold[c(grep(paste(">", scaffoldID, sep=''), scaffold)+1)]
seqs <- DNAStringSet(seqRaw)
#positive strands
pos <- ORFik::findORFs(seqs, startCodon = "ATG", minimumLength = MinLen)
#negative strands (DNAStringSet only if character)
neg <- ORFik::findORFs(reverseComplement(DNAStringSet(seqs)), startCodon = "ATG", minimumLength = MinLen)
pos <- relist(c(GRanges(pos,strand = "+"),GRanges(neg,strand = "-")),skeleton = merge(pos,neg))
#Process output
pos <- as.data.frame(pos)
pos$scaffoldID <- rep(scaffoldID, nrow(pos))
pos$ORFID <- paste("ORF_", seq(from=1, to=nrow(pos)), sep='')
#Extract and write ORFs from seq and produce AA sequence
for(i in 1:nrow(pos)){
if(as.character(pos$strand[i]) == "+"){
extSeq <- as.DNAbin(DNAStringSet(paste(strsplit(seqRaw, split='')[[1]][c(pos$start[i]:pos$end[i])], collapse = "")))
AAseq <- paste(paste(">", pos$scaffoldID[i], "_", pos$ORFID[i], sep=''), paste(as.character(trans(extSeq, code = 1, codonstart = 1))[[1]], collapse = ''), sep='\n')
write.table(AAseq, file = paste("AA_ORFs/", pos$scaffoldID[i], "_", pos$ORFID[i], ".fa", sep=''), col.names = F, row.names = F, quote = F)
}
if(as.character(pos$strand[i]) == "-"){
revComp <- reverseComplement(DNAStringSet(seqs))
extSeq <- as.DNAbin(DNAStringSet(paste(strsplit(as.vector(revComp), split='')[[1]][c(pos$start[i]:pos$end[i])], collapse = "")))
AAseq <- paste(paste(">", pos$scaffoldID[i], "_", pos$ORFID[i], sep=''), paste(as.character(trans(extSeq, code = 1, codonstart = 1))[[1]], collapse = ''), sep='\n')
write.table(AAseq, file = paste("AA_ORFs/", pos$scaffoldID[i], "_", pos$ORFID[i], ".fa", sep=''), col.names = F, row.names = F, quote = F)
}
}
#Merge all ORFs for BLAST analysis
system(paste("cat AA_ORFs/", pos$scaffoldID[i], "* > AA_ORFs/", pos$scaffoldID[i], "_ORFs.fa", sep=''))
system(paste("rm AA_ORFs/", pos$scaffoldID[i], "_ORF_*", sep=""))
#Save pos file
write.csv(pos, file = paste("ORFs_report/",pos$scaffoldID[i], "_", "ORFs.csv", sep=''), col.names = T, row.names = F, quote = F)
}
# Open FASTA file with target scaffold
scaffold <- readLines("Output_FASTAs/Scaffold151535.fa")
scaffoldID <- grep(pattern = "^>", x = scaffold, value = T)
scaffoldID <- gsub(pattern = ">", replacement = "", x = scaffoldID)
# Apply UDF to find ORFs and translate these into AA
# --> we will use the AA sequences to conduct a BLAST analysis and identify ORFs coding for Aquaporin exons
tryCatch(
{
for(i in 1:length(scaffoldID)){
findORFsTranslateDNA2AA(scaffold = scaffold, scaffoldID = scaffoldID[i], MinLen = 40)
}
})
FASTA files of translated ORFs. Let’s check these outputs.# Open the CSV output of the UDF containing data on predicted ORFs and associated sequences
orf.report <- read.csv("ORFs_report/Scaffold151535_ORFs.csv")
# How many ORFs were found?
nrow(orf.report)
# What are the longest ORFs?
orf.report[order(-orf.report$width),]
# Look at translated ORFs (=AA sequences)
translated.orfs <- readLines("AA_ORFs/Scaffold151535_ORFs.fa")
head(translated.orfs)
Here, we are visualizing the ORFs recovered by our analysis along each scaffold by producing maps saved in pdf format in ORFs_map/. The code also checks if the folder ORFs_map/ where files will be saved exists and if not creates it.
First study the code provided below and then execute it. Don’t forget to copy and paste it in your R script.
###
#Build map of scaffold with ORFs
###
#Read scaffold FASTA file (line by line)
scaffold <- readLines("Output_FASTAs/Scaffold151535.fa")
#List all files with ORFs
ORFfiles <- list.files(path = "ORFs_report", pattern = ".csv", full.names = T)
#Check if folder where ORF maps will be saved exists
# if not then creates it
output_dir <- file.path(paste0(getwd(), "/ORFs_map/"))
if(dir.exists(output_dir)){
print(paste0("Dir", output_dir, " already exists!"))
}else{
print(paste0("Created ", output_dir))
dir.create(output_dir)
}
#Produce a map (in pdf format) for each scaffold
for(i in 1:length(ORFfiles)){
print(ORFfiles[i])
#Read file in
ORF <- read.csv(ORFfiles[i])
#Process FASTA scaffold sequence
seq <- strsplit(scaffold[grep(paste(">", ORF$scaffoldID[1], sep=''), scaffold)+1], split='')
#Separate ORFs by strand
ORFplus <- subset(ORF, ORF$strand == "+")
ORFneg <- subset(ORF, ORF$strand == "-")
#Create plot
pdf(paste("ORFs_map/", ORF$scaffoldID[1], "_ORFs_annotated.pdf", sep=''))
#Initiate plot
plot(x=1, y=1, xlim=c(0,length(seq[[1]])), ylim=c(0,2), type='n', bty="n", axes=F, xlab = "", ylab='')
#Add title
text(x=5, y=2, paste(ORF$scaffoldID[1], " (strand: + in grey and - in blue)", sep=''), adj=0, cex=.8)
#Create a segment with length of scaffold
segments(x0=0, x1=length(seq[[1]]), y0=1, y1=1, col='black', lwd=3)
#Add ORFs: rectangles (grey: +, blue: -)
rect(xleft=ORFplus$start, xright=ORFplus$end, ybottom=0.75, ytop=1.25, col='grey')
rect(xleft=ORFneg$start, xright=ORFneg$end, ybottom=0.75, ytop=1.25, col='blue')
text(x=(ORFneg$start + ORFneg$end)/2, y=0.7, paste(ORFneg$ORFID, " (", ORFneg$start, ":", ORFneg$end, ")", sep=''), srt=90, col='blue', adj=1, cex=0.4)
text(x=(ORFplus$start + ORFplus$end)/2, y=1.3, paste(ORFplus$ORFID, " (", ORFplus$start, ":", ORFplus$end, ")", sep=''), srt=90, col='black', adj=0, cex=0.4)
#Add x axis
axis(side = 1)
mtext("Sequence (bp)", pos = c(0,0.5), side=1, line=2, cex.lab=0.6,las=1)
#Close pdf
dev.off()
}
Figure 11.1 shows the location of the predicted ORFs along Scaffold151535 inferred by the code displayed above.
Figure 11.1: Map of predicted ORFs along scaffold151535.
How many ORFs were discovered on
Scaffold151535?
How many ORFs are on the
+and-strands?
Write an R code based on ORFs_report/Scaffold151535_ORFs.csv to answer the questions.
In this module, we are conducting the following tasks:
The FASTA file Scaffold151535_ORFs.fa (see Figure 12.1) containing AA sequences of ORFs identified in module 2 is available on the shared Google Drive or on GitHub.
Figure 12.1: FASTA file containing all AA sequences for ORFs inferred along scaffold. See module 2 for more details.
Scaffold151535_ORFs.fa as shown in Figure 12.2 and press BLAST button to send the query.
Figure 12.2: Online protein BLAST form.
Figure 12.3: Output of the protein BLAST analysis. Use the dropdown button to select each ORF and identify their gene products.
How many ORFs on
Scaffold151535are coding for AQP exons and which are they?
Based on the BLAST analysis and the ORFs map (Figure 11.1), do you predict that the Aquaporin gene sequence in
Scaffold151535is complete or not? Please motivate your answer
Students are tasked to develop an R code producing the AA sequence of Aquaporin gene located on identified scaffold and its associated protein sequence.
Please find below a user defined function (UDF) that concatenates ORFs into a protein sequence in FASTA format. This function implements defensive programming aiming at providing the users with meaningful error messages to debug their code.
In this UDF, defensive programming has been implemented 2-ways:
FASTA file declared in fastaAA exists in the working directory (or in the provided path) and stops and return an error message pertaining to this issue if it doesn’t.ORFsToCat exists in the FASTA file (= declared in fastaAA) and stops and return an error message pertaining to this issue if they are not all present in the file.Finally, the UDF as a logical argument entitled stopCodon allowing to declare whether stop codons (represented by *) are present in the AA sequences (in your FASTA file). Here it is especially convenient since the concatenated protein sequence should not contain stop codons for our subsequent analyses. See UDF below for more details.
The function is provided below for you to inspect.
###~~~~
#ORFs2protSeq - A UDF to produce a protein sequence from ORFs
# Arguments:
# - fastaAA: Name of Fasta file containing ORFs AA sequences
# - ORFsToCat: vector with names of ORFs to concatenate (as in FASTA file and including ">" and in the right order)
# - stopCodon: Logical (TRUE/FALSE) variable to state whether stop (*) codons are in the AA sequences
# Output:
# - An object with the concatenated protein sequence in FASTA format
ORFs2protSeq <- function(fastaAA, ORFsToCat, stopCodon){
#Check if the FASTA file exists
checkFile <- file.exists(fastaAA)
if(checkFile == FALSE){
#Stop the function and print error
stop(call. = FALSE, paste(fastaAA, "does not exists! Please check that your working directory is set properly.", sep = " "))
}else{
#Open FASTA file
fas <- readLines(fastaAA)
#Find ORFs in Fasta file
ToFind <- match(ORFsToCat, fas)
#Check that all the ORFs were found in the Fasta
checkORFs <- is.na(ToFind)
if(length(which(checkORFs == TRUE)) > 0){
#Stop the function and print error
stop(call. = FALSE, paste(paste(ORFsToCat[which(checkORFs == TRUE)], collapse = " "), "couldn't be found in", fastaAA, " Please fix the error(s).", sep = " "))
}else{
print(paste("Producing protein sequence with", paste(ORFsToCat, collapse = ", "), sep = " "))
#Cat ORFs into AA sequence
protSeq <- paste(fas[ToFind+1], collapse = "")
if(is.logical(stopCodon) == TRUE){
#Discard stop codons from final sequence
protSeq <- gsub("[*]", "", protSeq)
}
}
#Produce final protein sequence in FASTA format
# header
head <- paste(">Protein_sequence_from_", paste(gsub("[>]", "", ORFsToCat), collapse = "|"), sep= "")
protSeqOUT <- paste(head, protSeq, sep = "\n")
print(protSeqOUT)
}
return(protSeqOUT)
}
In this section, we apply the UDF ORFs2protSeq to Scaffolds_groups.fasta (= fastaAA). First, we will use an example where the ORFsToCat argument contains ORFs that are not found in the FASTA file to demonstrate how defensive programming was implemented in the UDF.
The step-by-step approach is as follows:
Copy the UDF ORFs2protSeq() in your R code and execute it to source the function in the global environment (on the remote computer)
Apply ORFs2protSeq() to a FASTA file containing ORFs
#Name of the FASTA file (make sure the path is correct)
fastaAA <- "Data/Scaffold151535_ORFs.fa"
#Fasta headers of the ORFs you want to concatenate
# Here some ORFs names are faulty
ORFsToCat <- c(">Scaffold151535_ORF_1tt", ">Scaffold151535_ORF_13c", ">Scaffold151535_ORF_2")
#Stop codon
stopCodon <- TRUE
#Apply UDF
ORFs2protSeq(fastaAA, ORFsToCat, stopCodon)
## Error: >Scaffold151535_ORF_1tt >Scaffold151535_ORF_13c couldn't be found in Data/Scaffold151535_ORFs.fa Please fix the error(s).
FASTA file)#Name of the FASTA file
fastaAA <- "Data/Scaffold151535_ORFs.fa"
#Fasta headers of the ORFs you want to concatenate
# Here ORF names are accurate
ORFsToCat <- c(">Scaffold151535_ORF_1", ">Scaffold151535_ORF_13", ">Scaffold151535_ORF_2")
#Stop codon
stopCodon <- TRUE
#Apply UDF
ORFs2protSeq(fastaAA, ORFsToCat, stopCodon)
## [1] "Producing protein sequence with >Scaffold151535_ORF_1, >Scaffold151535_ORF_13, >Scaffold151535_ORF_2"
## [1] ">Protein_sequence_from_Scaffold151535_ORF_1|Scaffold151535_ORF_13|Scaffold151535_ORF_2\nMSSKPEIFEISSNDSTSSDSITSPWSSYFPSTYSNSVSKKSTAARSGKKVSTSVNPPVTTQALSMTSKRTQVLGLPTKENYAKITAKGKGKRTLTMEYLTILPEASALFNICLIGWSVMNFIGWASKYLRSLLAICSRARANFSMGAMHLCMHVCNEMLLVSVKIKLLVFIHHQCQNTTWYIVTCLDLTYQLNSYFKHKQKTQLHTFPTL"
## [1] ">Protein_sequence_from_Scaffold151535_ORF_1|Scaffold151535_ORF_13|Scaffold151535_ORF_2\nMSSKPEIFEISSNDSTSSDSITSPWSSYFPSTYSNSVSKKSTAARSGKKVSTSVNPPVTTQALSMTSKRTQVLGLPTKENYAKITAKGKGKRTLTMEYLTILPEASALFNICLIGWSVMNFIGWASKYLRSLLAICSRARANFSMGAMHLCMHVCNEMLLVSVKIKLLVFIHHQCQNTTWYIVTCLDLTYQLNSYFKHKQKTQLHTFPTL"
FASTA file located at a specific path on your remote computerThe objectives of this module are to validate the AQP protein sequences obtained in module 3 and infer its function. This will be done by conducting the following analyses:
R script relying on Biostring (Pagès et al., 2019) and IRanges (Lawrence et al., 2013) packages.To be valid, the AQP protein sequence should have:
To conduct this analysis (based on >Scaffold151535_ORF_26) do the following:
FASTA AA sequence generated in module 3, here corresponding to Scaffold151535_ORF_26 as shown in Figure 13.1 and submit the analysis.
Figure 13.1: Snapshot of TMHMM website showing how to submit job.
Figure 13.2: Snapshot of TMHMM results.
In this section, we are identifying the location and type of NPA motif along the AQP protein sequence. The instructors provide a template of an R code (based on Scaffold151535_ORF_26) to conduct this task relying on the Biostring (Pagès et al., 2019) and IRanges (Lawrence et al., 2013) packages. These latter packages should already be installed on your computer, but if they are not then install and load them as follows:
#Install Biostrings and IRanges (deposited on Bioconductor)
BiocManager::install("Biostrings")
BiocManager::install("IRanges")
#Load the packages to check installation
pkgs <- c("Biostrings", "IRanges")
lapply(pkgs, require, character.only = TRUE)
Now that the R packages are installed and loaded we can carry on with our coding:
##
#AA sequence
##
#User copy AA sequence in the object below
# Here, associated to Scaffold151535_ORF_26
AAseq <- "MEGKEEDVKLGANKYSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGIFSEKPLFQLSF*"
##
#Create a data.frame to store data on
# - N_NPA: Number of NPA motifs
# - NPA_motif: NPA motif
# - StartNPA: Starting position of NPA motif in AA seq
##
NPAdat <- data.frame("N_NPA" = numeric(length(AAseq)), "NPA_motif" = character(length(AAseq)), "StartNPA" = numeric(length(AAseq)))
#Start by matching to find NP motif and locations along sequence
tmp <- Biostrings::matchPattern(pattern = "NP", Biostrings::AAString(AAseq))
tmp <- as.data.frame(IRanges::ranges(tmp))
if(nrow(tmp) > 0){
#Print that it found NP motif
print("NP found")
#There is an NP motif
#N NP
NPAdat$N_NPA <- nrow(tmp)
#Infer motifs
NPAdat$NPA_motif <- paste(paste(rep("NP", nrow(tmp)), strsplit(as.vector(AAseq), split='')[[1]][as.numeric(tmp[,2]+1)], sep = ''), collapse = '/')
#Start motifs
NPAdat$StartNPA <- paste(tmp[,1], collapse = '/')
}else{
#There isn't an NP motif, so we look for a PA motif
tmp <- Biostrings::matchPattern(pattern = "PA", Biostrings::AAString(AAseq))
tmp <- as.data.frame(IRanges::ranges(tmp))
if(nrow(tmp) > 0){
#Print that it found PA motif
print("PA found")
#N NP
NPAdat$N_NPA <- nrow(tmp)
#Infer motifs
NPAdat$NPA_motif <- paste(paste(strsplit(as.vector(AAseq), split='')[[1]][as.numeric(tmp[,1]-1)], rep("PA", nrow(tmp)), sep = ''), collapse = '/')
#Start motifs
NPAdat$StartNPA <- paste(tmp[,1]-1, collapse = '/')
}else{
next
}
}
## [1] "PA found"
print(paste("The following NPA motifs were found for AA sequence:", AAseq, sep=" "))
## [1] "The following NPA motifs were found for AA sequence: MEGKEEDVKLGANKYSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGIFSEKPLFQLSF*"
print(NPAdat)
## N_NPA NPA_motif StartNPA
## 1 1 PPA 35
##
#Write data out
##
# If you want to write the data, execute the following command (don't forget to adjust your path)
#write.csv(NPAdat, file='Scaffold151535_ORF_26_NPA_motifs.csv', row.names = F, quote = F)
Based on your number of NPA motifs, how many hydrophobic loops does your Aquaporin protein contain? How does this result compare with the output of the TMHMM analysis?
To model 3D structure of AQP protein and predict its function do the following (here based on >Scaffold151535_ORF_26):
Phyre Search. The job will take ca. 50 minutes to run.
Figure 13.3: Snapshot of Phyre2 website used to model 3D structure of protein and predict its function.
Figure 13.4: Results of Phyre2 analysis.
Based on the analyses and data gathered in this lab, what are your interpretations and conclusions on the Aquaporin gene/protein located on
Scaffold151535?
Examples of questions that we could ask ourselves to answer the above question are:
Based on these latter evidence, do you think that the Aquaporin protein sequence is complete? The instructor invites you to consult Melton et al. (2021) for more information allowing answering these questions and come to a conclusion.
Each group is now working as a team to reproduce the analyses presented here on their assigned scaffold.
Good luck!
The FASTA file with scaffolds sequences can be downloaded here. The scaffolds assigned to each group are as followed:
The instructor provides below information to complete the group report. All the material, data, code and references required to complete this report are provided here and are covered in class. In this context, students will have to focus on formatting their reports following guidelines presented here as well as making sure that their code is working and ready to be shared. Please DON’T FORGET TO PROVIDE REFERENCES FOR SOFTWARE/PACKAGES cited in the Material & Methods section.
Your group reports will be structured and organized following the IMMRAD format: Introduction, Material & Methods, Results, and Discussion. This format is widely used to report experimental research in many scientific disciplines. In addition, you will be complementing your reports with an Abstract. Finally, since this research relies heavily on bioinformatics, students will complete their reports by supplying their data and commented code/scripts. Please see Mini-Report 3 for more details.
Please see evaluation rubrics for more information on grading.
Please see here for details on the deadline for this mandatory group assignment.
Students will use their lab reports to prepare 10 minutes presentations (+ 5 minutes for questions) taking place on April 29th 2026 (during class time).
The instructor expects each student to take part to the presentation and to be involved in answering questions.
Presentations will have to be deposited in advance onto a shared Google Drive folder. Please see evaluation rubrics for more information on grading.
This section provides the evaluation rubrics for both your group lab reports and oral presentations. Please review them carefully before submitting your final group report and preparing your oral presentation.
Your group lab report will be evaluated based on your ability to communicate a genome mining investigation clearly, accurately, and professionally using the IMRAD format (Introduction, Materials & Methods, Results, Discussion), and by providing reproducible data and code.
Each section is evaluated independently as outlined below.
| Criteria | Description | Points |
|---|---|---|
| Summary of study | Clearly summarizes the research question, methods, key results, and conclusions | 10 |
| Criteria | Description | Points |
|---|---|---|
| Scientific context and background | Clearly explains genome mining, gene annotation, and validation in the context of the study organism and target gene family | 10 |
| Research question and objectives | Clearly states the scientific question, objectives, and biological relevance of the investigation | 10 |
| Clarity and organization | Logical structure, clear writing, and appropriate use of scientific terminology | 5 |
| Criteria | Description | Points |
|---|---|---|
| Description of analytical workflow | Clearly and accurately describes genome mining, scaffold extraction, ORF prediction, annotation, and validation procedures | 15 |
| Reproducibility and transparency | Methods are described with sufficient detail to allow replication, including software, versions, parameters, and databases used | 10 |
| Code quality and documentation | Code/scripts are complete, functional, well-organized, and appropriately commented | 5 |
| Software and database citations | Proper citation of software, packages, and databases used | 5 |
| Criteria | Description | Points |
|---|---|---|
| Presentation of genome mining results | Clearly presents scaffold identification, ORF prediction, gene annotation, and validation results | 15 |
| Figures and tables | Figures and tables are clear, correctly labeled, and effectively support the findings | 10 |
| Accuracy and completeness | Results are accurate, complete, and presented without interpretation | 10 |
| Criteria | Description | Points |
|---|---|---|
| Interpretation of findings | Clearly explains the biological meaning of the identified and validated genes | 15 |
| Integration with scientific context | Connects findings to genome biology, gene function, and the original research question | 10 |
| Critical thinking | Discusses limitations, uncertainties, and potential future directions | 5 |
| Clarity and organization | Logical flow and clear scientific writing | 5 |
| Criteria | Description | Points |
|---|---|---|
| Data submission | Required data files are complete, organized, and accessible | 5 |
| Code submission | Scripts are functional, organized, and allow reproduction of analyses | 5 |
The following penalties may be applied:
| Issue | Penalty |
|---|---|
| Failure to follow formatting guidelines | Up to −15 points |
| Missing or incomplete code/data | Up to −15 points |
| Missing references or improper citation | Up to −10 points |
| Late submission | see Late Work Policy |
Presentation: 10 minutes + 5 minutes for questions
Expectations: All group members actively participate and respond to questions. Presentations must be submitted in advance to the shared Google Drive folder or sent to the instructor.
The presentation will be evaluated on how clearly and professionally the group communicates their research following the scientific process (IMRAD structure) and engages the audience.
| Criteria | Description | Points |
|---|---|---|
| Scientific context | Explains the relevant genome biology, gene annotation, and study organism clearly, providing necessary background | 5 |
| Research question & objectives | Clearly states the research question, objectives, and biological relevance | 3 |
| Clarity and engagement | Information is logically organized, concise, and engages the audience | 2 |
| Criteria | Description | Points |
|---|---|---|
| Explanation of workflow | Clearly describes genome mining, ORF prediction, annotation, and validation steps appropriate for oral communication | 5 |
| Reproducibility and transparency | Describes tools, software, and databases used with enough detail for comprehension | 3 |
| Clarity & conciseness | Methods are presented in an understandable, well-structured way for the audience | 2 |
| Criteria | Description | Points |
|---|---|---|
| Presentation of findings | Results are clearly explained, including scaffold identification, gene annotation, and validation | 5 |
| Visual aids | Figures, tables, and slides are clear, correctly labeled, and enhance audience understanding | 4 |
| Accuracy & completeness | Results are accurate and complete, presented without misinterpretation | 3 |
| Criteria | Description | Points |
|---|---|---|
| Interpretation of findings | Clearly explains biological significance and connects to research question | 5 |
| Integration with context | Connects results to genome biology, gene function, or broader implications | 3 |
| Critical thinking | Discusses limitations, uncertainties, and potential next steps | 2 |
| Criteria | Description | Points |
|---|---|---|
| Participation | All group members contribute and respond to questions | 3 |
| Clarity & delivery | Speech is clear, confident, and well-paced; avoids excessive reading from slides | 3 |
| Audience engagement | Effectively engages listeners, maintains attention, and handles questions professionally | 2 |
| Issue | Penalty |
|---|---|
| Exceeding 10-minute presentation time | Up to −3 points |
| Failing to present | see Late Work Policy |
The instructor would like to thank Dr Anthony Melton (University of Montevallo, Montevallo, AL) for his incredible support with the analyses presented in this group activity.